PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G15110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 370aa    MW: 39773.3 Da    PI: 5.9055
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G15110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.64.3e-11171229563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l++l+     l+se+
  OPUNC04G15110.1 171 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLSMLQRDTTGLTSEN 229
                      9************************************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-18167231IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.139169232IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-11171226No hitNo description
SuperFamilySSF579592.74E-11171226No hitNo description
PfamPF001701.5E-9171229IPR004827Basic-leucine zipper domain
CDDcd147031.48E-22172221No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDPAASASSS AAESSPSSLS LSSRDVAAMP DSPPRRAARH RRAQSEILLG AALPDDIAFD  60
ADLGVVGEVG GGGGDDYEEE EEDDEEEEME GAGGSRMFEM FLEAGGKLEP PEPTAPLPPP  120
PARPRHQHSM SMDGSTSLAS SAAGVAGRMG ADAKKAISDA KLAELALVDP KRAKRILANR  180
QSAARSKERK MRYIAELERK VQTLQTEATT LSAQLSMLQR DTTGLTSENS DLKIRVQTME  240
QQVRLQDALN DRLRDEIQQL KVATGQVNAN CGKVGNFGLS SFGGANPQGY QRSHIQSLLA  300
AQQLQQLQIH SQHQQQQMHL QHHHHLSTVQ QQLLQEGLPL PGDLKMKGIA VASHAQNTGA  360
SESHALRSEP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6066270.0AL606627.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0067K08, complete sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633411.11e-169PREDICTED: transcription factor RF2a-like
SwissprotQ040888e-86POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0E0KSA80.0A0A0E0KSA8_ORYPU; Uncharacterized protein
STRINGLOC_Os04g41820.11e-168(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-67bZIP family protein